BHLHA9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23799725UL

Catalog No. NB436345

Description

BHLHA9 Polyclonal specifically detects BHLHA9 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BHLHA9
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q7RTU4
• Gene Symbols: BHLHA9
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SKARRMAANVRERKRILDYNEAFNALRRALRHDLGGKRLSKIATLRRAIHRIAALSLVLRASPAPRGPCGHLECHG
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Basic Helix-Loop-Helix Family, Member A9, bHLHa9, BHLHF42, Class A Basic Helix-Loop-Helix Protein 9, Class F Basic Helix-Loop-Helix Factor 42, Class II Basic Helix-Loop-Helix Protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 727857
• Target Species: Human
• Isotype: IgG