BHLHB5 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310296100UL

Catalog No. NB125493

Description

BHLHB5 Polyclonal specifically detects BHLHB5 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BHLHB5
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: Basic Helix-Loop-Helix Domain Containing, Class B, 5, basic helix-loop-helix family, member e22, Beta3, BHLHE22, CAGL85, Class B Basic Helix-Loop-Helix Protein 5, Class E Basic Helix-Loop-Helix Protein 22, TNRC20, Trinucleotide Repeat Containing 20, Trinucleotide Repeat-Containing Gene 20 Protein
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BHLHB5 (NP_689627). Peptide sequence LPAGAALCLKYGESASRGSVAESSGGEQSPDDDSDGRCELVLRAGVADPR
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 27319
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.