Biliverdin Reductase B/BLVRB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB418959	Novus Biologicals NBP18343425UL	25 μL
NBP183434	Novus Biologicals NBP183434	0.1 mL

Description

Biliverdin Reductase B/BLVRB Polyclonal specifically detects Biliverdin Reductase B/BLVRB in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Biliverdin Reductase B/BLVRB
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 645
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DVDKTVAGQDAVIVLLGTRNDLSPTTVMSEGARNIVAAMKAHGVDKVVACTSAFLLWDPTKVPPRLQAVTDDH
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Alias: Biliverdin reductase B, biliverdin reductase B (flavin reductase (NADPH)), Biliverdin-IX beta-reductase, BVR-B, EC 1.3.1.24, EC 1.5.1.30, flavin reductase, flavin reductase (NADPH), FLRBVRB, FR, GHBP, Green heme-binding protein, MGC117413, NADPH-dependent diaphorase, NADPH-flavin reductase, SDR43U1, short chain dehydrogenase/reductase family 43U, member 1
• Gene Symbols: BLVRB
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only