Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BLAME/SLAMF8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | BLAME/SLAMF8 |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
BLAME/SLAMF8 Polyclonal specifically detects BLAME/SLAMF8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
BLAME/SLAMF8 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
56833 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SEITYSWRRETTMDFGMEPHSLFTDGQVLSISLGPGDRDVAYSCIVSNPVSWDLATVTPWDSCHHEAAPGKASYKD | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Polyclonal | |
Rabbit | |
Human | |
B Lymphocyte Activator Macrophage Expressed, BCM-Like Membrane Protein, B-Lymphocyte Activator Macrophage Expressed, CD353, CD353 Antigen, SBBI42, SLAM Family Member 8, SLAMF8 | |
SLAMF8 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title