Learn More
Description
Specifications
Specifications
| Antigen | BLNK |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide |
| Gene Alias | AGM4, B cell linker protein, BASH, B-cell adapter containing a SH2 domain protein, B-cell adapter containing a Src homology 2 domain protein, B-cell linker, B-cell linker protein, BLNK-s, Cytoplasmic adapter protein, LY57, MGC111051, SLP-65BLNK-S, SLP65Ly57, Src homology 2 domain-containing leukocyte protein of 65 kDa |
| Gene Symbols | BLNK |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: HSPPFSKTLPSKPSWPSEKARLTSTLPALTALQKPQVPPKPKGLLEDEADYVVPVEDNDENYIHPTESSSPPPEKAPMVNRSTKPNSS |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
