Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Blood group H inhibitor Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310979100UL
Description
Blood group H inhibitor Polyclonal specifically detects Blood group H inhibitor in Mouse samples. It is validated for Western Blot.Specifications
Blood group H inhibitor | |
Polyclonal | |
Western Blot 1.0 ug/ml | |
alpha (1,2) fucosyltransferase, Alpha(1,2)FT 1,2-alpha-L-fucosyltransferase, Blood group H alpha 2-fucosyltransferase, EC 2.4.1.69, Fucosyltransferase 1, fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, Bombayphenotype included), fucosyltransferase 1 (galactoside 2-alpha-L-fucosyltransferase, H blood group), galactoside 2-alpha-L-fucosyltransferase 1, GDP-L-fucose:beta-D-galactoside 2-alpha-L-fucosyltransferase 1, HHH, HSC | |
The immunogen is a synthetic peptide directed towards the C terminal region of mouse Blood group H inhibitor. Peptide sequence ALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFLKIFRPEAA | |
100 μg | |
Primary | |
Mouse | |
Purified |
Western Blot | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
2523 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction