Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. BMI-1 Antibody, Novus Biologicals™

BMI-1 Antibody, Novus Biologicals™
SDP

Catalog No. NB435372 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB435372 25 μL
NBP257552 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB435372 Supplier Novus Biologicals Supplier No. NBP25755225UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

BMI-1 Polyclonal specifically detects BMI-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen BMI-1
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias B lymphoma Mo-MLV insertion region 1 homolog, B lymphoma Mo-MLV insertion region 1 homolog (mouse), BMI1 polycomb ring finger oncogene, FLVI2/BMI1, MGC12685, murine leukemia viral (bmi-1) oncogene homolog, PCGF4, polycomb complex protein BMI-1, polycomb group protein Bmi1, polycomb group ring finger 4, RING finger protein 51, RNF51Polycomb group RING finger protein 4
Gene Symbols BMI1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, Cancer Stem Cells, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics, Hematopoietic Stem Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 648
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.