Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BMI-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25755225UL
Description
BMI-1 Polyclonal specifically detects BMI-1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
BMI-1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
B lymphoma Mo-MLV insertion region 1 homolog, B lymphoma Mo-MLV insertion region 1 homolog (mouse), BMI1 polycomb ring finger oncogene, FLVI2/BMI1, MGC12685, murine leukemia viral (bmi-1) oncogene homolog, PCGF4, polycomb complex protein BMI-1, polycomb group protein Bmi1, polycomb group ring finger 4, RING finger protein 51, RNF51Polycomb group RING finger protein 4 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
BMI1 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYE | |
25 μL | |
Breast Cancer, Cancer, Cancer Stem Cells, Cell Biology, Cell Cycle and Replication, Chromatin Research, DNA Repair, DNA replication Transcription Translation and Splicing, Epigenetics, Hematopoietic Stem Cell Markers, Neuronal Stem Cell Markers, Stem Cell Markers, Transcription Factors and Regulators | |
648 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction