Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ BMP-2 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA578874
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA578874 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA578874 Supplier Invitrogen™ Supplier No. PA578874
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Lung Tissue, Rat Brain Tissue, U87 whole cell, HELA whole cell. IHC: human intestinal cancer tissue.

Bone Morphogenic Proteins (BMP) are members of the TGF-beta superfamily that affect bone and cartilage formation (Hogan 1996, Reddi 1998 and Francis-West et al. 1999). Mature BMPs are 30-38 kDa proteins that assume a TGF-beta -like cysteine knot configuration. Lovostatin increases bone formation by turning on the bmp-2 gene (Mundy et al. 1999). BMPs stimulate the production of specific bone matrix proteins and alter stromal cell and osteoclast proliferation (Macias et al. 1999, Lecanda et al. 1997). BMPs may also be an important factor for development of the viscera, with roles in cell proliferation, apoptosis, differentiation, and morphogenesis (Hogan 1996, Dale and Wardle 1999). BMPs appear to be responsible for normal dorsal/ventral patterning. Like TGF-beta, BMPs bind to a type II receptor, which then recruits the transducing type I receptor unit, activating the Smad protein signaling pathway (Massague 1994, Derynck 1997, Attisano 1993).
TRUSTED_SUSTAINABILITY

Specifications

Antigen BMP-2
Applications ELISA, Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene BMP2
Gene Accession No. P12643, P49001
Gene Alias 2610024H22Rik; AI467020; AL117858; AW546137; BB189135; BDA2; BMP; BMP2; BMP-2; BMP2A; BMP-2A; BMPRII; BMPR-II; Bone morphogenetic; Bone morphogenetic protein; Bone morphogenetic protein 2; bone morphogenetic protein 2 precursor (BMP-2) (BMP-2A); bone morphogenetic protein 2A; H-BMP-2; morphogen
Gene Symbols BMP2
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29373, 650
Target Species Human, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.