Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ BMP-2 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA578874
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Rat Lung Tissue, Rat Brain Tissue, U87 whole cell, HELA whole cell. IHC: human intestinal cancer tissue.
Bone Morphogenic Proteins (BMP) are members of the TGF-beta superfamily that affect bone and cartilage formation (Hogan 1996, Reddi 1998 and Francis-West et al. 1999). Mature BMPs are 30-38 kDa proteins that assume a TGF-beta -like cysteine knot configuration. Lovostatin increases bone formation by turning on the bmp-2 gene (Mundy et al. 1999). BMPs stimulate the production of specific bone matrix proteins and alter stromal cell and osteoclast proliferation (Macias et al. 1999, Lecanda et al. 1997). BMPs may also be an important factor for development of the viscera, with roles in cell proliferation, apoptosis, differentiation, and morphogenesis (Hogan 1996, Dale and Wardle 1999). BMPs appear to be responsible for normal dorsal/ventral patterning. Like TGF-beta, BMPs bind to a type II receptor, which then recruits the transducing type I receptor unit, activating the Smad protein signaling pathway (Massague 1994, Derynck 1997, Attisano 1993).
Specifications
BMP-2 | |
Polyclonal | |
Unconjugated | |
BMP2 | |
2610024H22Rik; AI467020; AL117858; AW546137; BB189135; BDA2; BMP; BMP2; BMP-2; BMP2A; BMP-2A; BMPRII; BMPR-II; Bone morphogenetic; Bone morphogenetic protein; Bone morphogenetic protein 2; bone morphogenetic protein 2 precursor (BMP-2) (BMP-2A); bone morphogenetic protein 2A; H-BMP-2; morphogen | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
29373, 650 | |
-20°C | |
Lyophilized |
ELISA, Immunohistochemistry (Paraffin), Western Blot | |
500 μg/mL | |
PBS with 5mg BSA and 0.05mg sodium azide | |
P12643, P49001 | |
BMP2 | |
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-2 (283-312aa QAKHKQRKRLKSSCKRHPLYVDFSDVGWND). | |
100 μg | |
Primary | |
Human, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction