Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BMP-6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$336.16 - $691.20
Specifications
| Antigen | BMP-6 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BMP-6 Polyclonal specifically detects BMP-6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| BMP-6 | |
| Polyclonal | |
| Rabbit | |
| Cytokine Research | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 654 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSELKTACRKHELY | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| BMP-6, bone morphogenetic protein 6, vegetal related growth factor (TGFB-related), vegetal-related (TGFB related) cytokine, VG-1-R, VG-1-related protein, Vg1-related sequence, VGR, VGR1, VGR-1 | |
| BMP6 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title