Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BMP2K Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BMP2K |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BMP2K Polyclonal specifically detects BMP2K in Human samples. It is validated for Western Blot.Specifications
BMP2K | |
Polyclonal | |
Rabbit | |
Protein Kinase, Stem Cell Signaling Pathway | |
BIKe, BMP2 inducible kinase, BMP-2-inducible protein kinase, DKFZp434K0614, DKFZp434P0116, EC 2.7.11.1 | |
BMP2K | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q4W5H2 | |
55589 | |
Synthetic peptides corresponding to BMP2K(BMP2 inducible kinase) The peptide sequence was selected from the middle region of BMP2K. Peptide sequence VKVLAPGEFGNHRPKGALRPGNGPEILLGQGPPQQPPQQHRVLQQLQQGD. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title