Invitrogen™ BMP4 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578876

Catalog No. PIPA578876

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Mouse Lung Tissue, Mouse Liver Tissue, HEPA whole cell, HEPG2 whole cell, HELA whole cell.

The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.

Specifications

• Antigen: BMP4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: BMP4
• Gene Alias: BMP; BMP2B; BMP-2B; Bmp2b1; Bmp2b-1; Bmp4; Bmp-4; BOMPR4A; Bone morphogenetic protein; Bone morphogenetic protein 2B; bone morphogenetic protein 4; bone morphogenetic protein 4 preproprotein; DVR4; Dvr-4; MCOPS6; OFC11; ZYME
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 12159, 652
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: ELISA, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P12644, P21275
• Gene Symbols: BMP4
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov