Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ BMP4 Polyclonal Antibody

Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA578876
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: Mouse Lung Tissue, Mouse Liver Tissue, HEPA whole cell, HEPG2 whole cell, HELA whole cell.
The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.
Specifications
| BMP4 | |
| Polyclonal | |
| Unconjugated | |
| BMP4 | |
| BMP; BMP2B; BMP-2B; Bmp2b1; Bmp2b-1; Bmp4; Bmp-4; BOMPR4A; Bone morphogenetic protein; Bone morphogenetic protein 2B; bone morphogenetic protein 4; bone morphogenetic protein 4 preproprotein; DVR4; Dvr-4; MCOPS6; OFC11; ZYME | |
| Rabbit | |
| Antigen affinity chromatography | |
| RUO | |
| 12159, 652 | |
| -20°C | |
| Lyophilized |
| ELISA, Western Blot | |
| 500 μg/mL | |
| PBS with 5mg BSA and 0.05mg sodium azide | |
| P12644, P21275 | |
| BMP4 | |
| A synthetic peptide corresponding to a sequence at the C-terminus of human BMP-4 (293-324aa SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND). | |
| 100 μg | |
| Primary | |
| Human, Mouse | |
| Antibody | |
| IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction