Invitrogen™ BMP5 Polyclonal Antibody, DyLight™ 488

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA578877

Catalog No. PIPA578877

Description

Positive Control - Flow: U20S cell.

TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling, and maintenance of a variety of other tissues and organs. BMP-5 is expressed in the nervous system, lungs and liver. It is a known regulator for dendritic growth in sympathetic neurons. BMP-5 is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein.

Specifications

• Antigen: BMP5
• Classification: Polyclonal
• Conjugate: DyLight 488
• Gene: Bmp5
• Gene Alias: AU023399; BMP; BMP 5; Bmp5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; bone morphogenetic protein 5; MGC34244; se; short ear
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 653
• Content And Storage: 4°C, store in dark, DO NOT FREEZE!
• Form: Liquid

• Applications: Flow Cytometry
• Concentration: 200 μg/mL
• Formulation: PBS with 50% glycerol and 0.02% sodium azide
• Gene Accession No.: P22003
• Gene Symbols: Bmp5
• Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov