BNIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169182

Catalog No. NBP169182

Description

BNIP1 Polyclonal specifically detects BNIP1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: BNIP1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: BCL2/adenovirus E1B 19 kDa protein-interacting protein 1, BCL2/adenovirus E1B 19kDa interacting protein 1, BCL2/adenovirus E1B 19kD-interacting protein 1, NIP1, SEC20, SEC20L, Transformation-related gene 8 protein, TRG-8, vesicle transport protein SEC20
• Host Species: Rabbit
• Molecular Weight of Antigen: 30 kDa
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 662
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q12981-1
• Gene Symbols: BNIP1
• Immunogen: Synthetic peptides corresponding to BNIP1 (BCL2/adenovirus E1B 19kDa interacting protein 1) The peptide sequence was selected from the N terminal of BNIP1. Peptide sequence DFNSPTTPVTFSDLEQLAKEQDKESEKQLLLQEVENHKKQMLSNQASWRK.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Zebrafish: 75%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG