Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BNIP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | BNIP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
BNIP1 Polyclonal specifically detects BNIP1 in Human samples. It is validated for Western Blot.Specifications
| BNIP1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis | |
| BCL2/adenovirus E1B 19 kDa protein-interacting protein 1, BCL2/adenovirus E1B 19kDa interacting protein 1, BCL2/adenovirus E1B 19kD-interacting protein 1, NIP1, SEC20, SEC20L, Transformation-related gene 8 protein, TRG-8, vesicle transport protein SEC20 | |
| BNIP1 | |
| IgG | |
| 26 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q12981 | |
| 662 | |
| Synthetic peptides corresponding to BNIP1 (BCL2/adenovirus E1B 19kDa interacting protein 1) The peptide sequence was selected from the C terminal of BNIP1. Peptide sequence QSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALA. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title