Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ Bone SialoProtein Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA579423
Description
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue.
The protein encoded by this gene is a major structural protein of the bone matrix. It constitutes approximately 12% of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor.
Specifications
Bone SialoProtein | |
Polyclonal | |
Unconjugated | |
Ibsp | |
BNSP; Bone sialoprotein 2; bone sialoprotein II; Bsp; BSP II; Bsp2; BSPII; BSP-II; Cell-binding sialoprotein; IBSP; integrin binding sialoprotein; integrin-binding sialoprotein; SP-II | |
Rabbit | |
Antigen affinity chromatography | |
RUO | |
15891, 24477, 3381 | |
-20°C | |
Lyophilized |
Western Blot | |
500 μg/mL | |
PBS with 4mg trehalose and 0.05mg sodium azide | |
P13839, P21815, Q61711 | |
Ibsp | |
A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ). | |
100 μg | |
Primary | |
Human, Mouse, Rat | |
Antibody | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction