Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BRD3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
Antigen | BRD3 |
---|---|
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BRD3 Polyclonal specifically detects BRD3 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
BRD3 | |
Polyclonal | |
Rabbit | |
Protein Kinase | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
8019 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: MPQEEVELLPPAPKGKGRKPAAGAQSAGTQQVAAVSSVSPATPFQSVPPTVSQTPVIAATPVPTITANVTSV | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
bromodomain containing 3, bromodomain-containing protein 3, KIAA0043FLJ41328, ORFXbromodomain-containing 3, RING3LFLJ23227, RING3-like protein | |
BRD3 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title