Learn More
Description
Specifications
Specifications
| Antigen | BRF1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | B-related factor 1, BRF-1, BRF1 homolog, subunit of RNA polymerase III transcription initiation factorIIIB (S. cerevisiae), BRFFLJ42674, general transcription factor IIIB, 90kD subunit, GTF3BTAFIII90, hBRFMGC105048, hTFIIIB90, TAF3B2, TAF3CB - related factor 1, TATA box binding protein (TBP)-associated factor 3C, TATA box binding protein (TBP)-associated factor, RNA polymerase III, GTF3Bsubunit 2, TATA box binding protein (TBP)-associated factor, RNA polymerase III, subunit 2, TATA box-binding protein-associated factor, RNA polymerase III, subunit 2, TBP - associated factor, RNA polymerase III, 90kD, TF3B90, TFIIIB90FLJ43034, transcription factor IIIB 90 kDa subunit |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: ASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAEYLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQ |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
