Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BRI3BP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $665.78

Specifications

Antigen	BRI3BP
Dilution	Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB431258 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18856425UL	25 μL	Each for $382.00	Only null left	Sign In or Register to check your price. Add to Cart

NBP188564 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP188564	0.1 mL	Each for $665.78	Only null left	Sign In or Register to check your price. Add to Cart

Description

BRI3BP Polyclonal specifically detects BRI3BP in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	BRI3BP
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	140707
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:MFVETLWKVWTELLDVLGLDVSNLSQYFSPASVSSSPARALLLVGVV
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human
Gene Alias	BNAS1, BRI3 binding protein, BRI3-binding protein, Cervical cancer 1 proto-oncogene-binding protein KG19, cervical cancer oncogene binding protein, HCCR-1, HCCR-2, HCCRBP-1, KG19I3-binding protein
Gene Symbols	BRI3BP
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

BRI3BP Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents