BRIX Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP19170825UL

Catalog No. NB430007

Description

BRIX Polyclonal specifically detects BRIX in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: BRIX
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 ug/mL, Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 0.25 to 2 ug/mL, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: brix domain containing 2, Brix domain-containing protein 2, BRIXBXDC2, BRX1, biogenesis of ribosomes, homolog (S. cerevisiae), FLJ11100, ribosome biogenesis protein BRX1 homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of human BRIX antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: BRIX1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LYENPHYQSPNMHRRVIRSITAAKYREKQQVKDVQKLRKKEPKTLLPHDPTADVFVTPAEEKPIEIQWVKPEPKVDLKARKKRIYK
• Quantity: 25 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 55299
• Target Species: Human, Mouse, Rat
• Isotype: IgG

For Research Use Only