Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
BTBD10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | BTBD10 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
BTBD10 Polyclonal specifically detects BTBD10 in Human samples. It is validated for Western Blot.Specifications
BTBD10 | |
Polyclonal | |
Rabbit | |
NP_115696 | |
84280 | |
Synthetic peptide directed towards the N terminal of human BTBD10. Peptide sequence AGRPHPYDGNSSDPENWDRKLHSRPRKLYKHSSTSSRIAKGGVDHTKMSL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BTB (broad-complex tramtrack and bric-a-brac/pox virus and zinc finger)domain-containing protein 10, BTB (POZ) domain containing 10, BTB/POZ domain-containing protein 10, GMRP1, GMRP-1, K+ channel tetramerization protein, KSARCOSIN, MGC13007 | |
BTBD10 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title