Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ BTLA Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA595592
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA595592 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA595592 Supplier Invitrogen™ Supplier No. PA595592
Add to Cart
Edge
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human HEK293 whole cell, human Jurkat whole cell, human CCRF-CEM whole cell, mouse thymus tissue. IHC: mouse spleen tissue, mouse spleen tissue, human tonsil tissue. Flow: THP-1 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

BTLA or B and T-lymphocyte attenuator is a member of the co-inhibitory receptors of the CD28 superfamily. BTLA is a lymphocyte inhibitory receptor which inhibits lymphocytes during immunes responses. BTLA is constitutively expressed on most CD4+ and CD8+ T cells and its expression progressively decreases upon T cell activation. It remains expressed on Th1 cells, but not Th2 cells. BTLA is a unique co-receptor that interacts with the tumor necrosis factor receptor superfamily member herpesvirus entry mediator (HVEM). This interation is an important pathway regulating lymphocyte activation and/or homeostasis in the immune response.
TRUSTED_SUSTAINABILITY

Specifications

Antigen BTLA
Applications Flow Cytometry, Immunohistochemistry (Frozen), Immunohistochemistry (Paraffin), Western Blot, Immunocytochemistry
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene BTLA
Gene Accession No. Q7TSA3, Q7Z6A9
Gene Alias A630002H24; B and T lymphocyte associated; B and T lymphocyte associated protein; B and T lymphocyte attenuator; B- and T-lymphocyte attenuator; B- and T-lymphocyte-associated protein; BTLA; BTLA_HUMAN; BTLA1; CD272; CD272 antigen; FLJ16065; MGC129743
Gene Symbols BTLA
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human CD272/BTLA (QSNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRL).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 151888, 208154
Target Species Human, Mouse
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.