Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

BTLA Rabbit anti-Human, Polyclonal , Abnova™

Rabbit polyclonal antibody raised against partial recombinant human BTLA.

Manufacturer:  Abnova Corporation PAB29564

Catalog No. 89-933-677

This item has been discontinued by the manufacturer and is no longer available. Please call customer service for assistance: 1-800-766-7000.


Description

Description

BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 (MIM 600244) and CTLA4 (MIM 123890), BTLA interacts with a B7 homolog, B7H4.[supplied by OMIM]

Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRP
Specifications

Specifications

BTLA
Unconjugated
Affinity Purified
BTLA
Recombinant protein corresponding to amino acids 31-152 of human BTLA.
Antigen affinity purification
RUO
Primary
151888
Immunohistochemistry (Paraffin)
In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
BTLA1, CD272, FLJ16065, MGC129743
Rabbit
IgG
100μL
Store at 4°C. For long term storage store at −20°C. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
SDS
Documents
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit