Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89933677

BTLA Rabbit anti-Human, Polyclonal , Abnova™

Catalog No. 89933677 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-933-677 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-933-677 Supplier Abnova Corporation Supplier No. PAB29564

Description

Rabbit polyclonal antibody raised against partial recombinant human BTLA.

BTLA expression is induced during activation of T cells, and BTLA remains expressed on Th1 cells but not Th2 cells. Like PD1 (MIM 600244) and CTLA4 (MIM 123890), BTLA interacts with a B7 homolog, B7H4.[supplied by OMIM]

Sequence: KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRP

Specifications

Antigen BTLA
Applications Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Formulation In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene Alias BTLA1, CD272, FLJ16065, MGC129743
Gene Symbols BTLA
Host Species Rabbit
Immunogen Recombinant protein corresponding to amino acids 31-152 of human BTLA.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 151888
Target Species Human
Content And Storage Store at 4°C. For long term storage store at −20°C. Aliquot to avoid repeated freezing and thawing.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.