Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Buster3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Buster3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Buster3 Polyclonal specifically detects Buster3 in Human samples. It is validated for Western Blot.Specifications
Buster3 | |
Polyclonal | |
Rabbit | |
Buster3, chromosome 5 open reading frame 54 | |
C5orf54 | |
IgG | |
68 kDa |
Western Blot | |
Unconjugated | |
RUO | |
63920 | |
Synthetic peptides corresponding to LOC63920 (chromosome 5 open reading frame 54) The peptide sequence was selected from the N terminal of LOC63920)(50ug). Peptide sequence SVFSNADLRPSKLSDHFNRQHGGVAGHDLNSLKHMPAPSDQSETLKAFGV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title