Butyrylcholinesterase/BCHE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169541

Catalog No. NBP169541

Description

Butyrylcholinesterase/BCHE Polyclonal specifically detects Butyrylcholinesterase/BCHE in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Butyrylcholinesterase/BCHE
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Acylcholine acylhydrolase, Butyrylcholine esterase, butyrylcholinesterase, CHE1cholinesterase, Choline esterase II, cholinesterase 1, E1, EC 3.1.1.8, Pseudocholinesterase
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P06276
• Gene Symbols: BCHE
• Immunogen: Synthetic peptides corresponding to BCHE(butyrylcholinesterase) The peptide sequence was selected from the N terminal of BCHE. Peptide sequence SSLHVYDGKFLARVERVIVVSMNYRVGALGFLALPGNPEAPGNMGLFDQQ.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 590
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Form: Purified

For Research Use Only