Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB237474

c-jun Antibody, Novus Biologicals™
SDP

Catalog No. NB237474 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB237474 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB237474 Supplier Novus Biologicals Supplier No. NBP321253
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

c-jun Polyclonal antibody specifically detects c-jun in Human samples. It is validated for Western Blot

Specifications

Antigen c-jun
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Activator protein 1, AP1, AP-1, c-Jun, enhancer-binding protein AP1, Jun activation domain binding protein, jun oncogene, jun proto-oncogene, Proto-oncogene c-Jun, transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homologp39, v-jun sarcoma virus 17 oncogene homolog, v-jun sarcoma virus 17 oncogene homolog (avian)
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: ANLSNFNPGALSSGGGAPSYGAAGLAFPAQPQQQQQPPHHLPQQMPVQHPRLQALKEEPQTVPEMPGETPPLSPIDMESQE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Cycle and Replication, Hypoxia, Immunology, Innate Immunity, Phospho Specific, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors, Wnt Signaling Pathway
Primary or Secondary Primary
Gene ID (Entrez) 3725
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.