c-jun Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324744

Catalog No. NB301708

Description

c-jun Polyclonal antibody specifically detects c-jun in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: c-jun
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Activator protein 1, AP1, AP-1, c-Jun, enhancer-binding protein AP1, Jun activation domain binding protein, jun oncogene, jun proto-oncogene, Proto-oncogene c-Jun, transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homologp39, v-jun sarcoma virus 17 oncogene homolog, v-jun sarcoma virus 17 oncogene homolog (avian)
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein c-jun using the following amino acid sequence: PTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSE
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Hypoxia, Immunology, Innate Immunity, Phospho Specific, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors, Wnt Signaling Pathway
• Gene ID (Entrez): 3725
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified