Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
c-jun Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25693225UL
Description
c-jun Polyclonal specifically detects c-jun in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Jun | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
Activator protein 1, AP1, AP-1, c-Jun, enhancer-binding protein AP1, Jun activation domain binding protein, jun oncogene, jun proto-oncogene, Proto-oncogene c-Jun, transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homologp39, v-jun sarcoma virus 17 oncogene homolog, v-jun sarcoma virus 17 oncogene homolog (avian) | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
JUN | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT | |
25 μL | |
Apoptosis, Cancer, Cell Cycle and Replication, Hypoxia, Immunology, Innate Immunity, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors, Wnt Signaling Pathway | |
3725 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction