c-jun Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256932

Catalog No. NBP256932

Description

c-jun Polyclonal specifically detects c-jun in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Jun
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: Activator protein 1, AP1, AP-1, c-Jun, enhancer-binding protein AP1, Jun activation domain binding protein, jun oncogene, jun proto-oncogene, Proto-oncogene c-Jun, transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene homologp39, v-jun sarcoma virus 17 oncogene homolog, v-jun sarcoma virus 17 oncogene homolog (avian)
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: JUN
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
• Quantity: 100 μL
• Research Discipline: Apoptosis, Cancer, Cell Cycle and Replication, Hypoxia, Immunology, Innate Immunity, Signal Transduction, Transcription Factors and Regulators, Tumor Suppressors, Wnt Signaling Pathway
• Gene ID (Entrez): 3725
• Target Species: Human
• Isotype: IgG

For Research Use Only