Novus Biologicals™ c-Myc Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human c-Myc. Source: E.coli Amino Acid Sequence: QAPGKRSESGSPSAGGHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP The c-Myc Recombinant Protein Antigen is derived from E. coli. The c-Myc Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 4609
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: c-Myc Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: avian myelocytomatosis viral oncogene homolog, BHLHE39, bHLHe39MRTL, Class E basic helix-loop-helix protein 39, c-Myc, MYC, myc proto-oncogene protein, MYCC, myc-related translation/localization regulatory factor, Proto-oncogene c-Myc, Transcription facto
• Gene Symbol: MYC
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Category: Autophagy, Cancer, Cancer Stem Cells, Cell Cycle and Replication, Chromatin Research, Core ESC Like Genes, Epigenetics, Epitope Tags, Stem Cell Markers, Transcription Factors and Regulators, Tumor Suppressors
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52956. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.