Invitrogen™ c-Rel Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA579922

Catalog No. PIPA579922

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human THP-1 whole cell, rat spleen tissue, mouse thymus tissue. IHC: mouse Intestine tissue, rat Intestine tissue, human mammary cancer tissue.

The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA., RELB (604758), NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain, ' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (Belguise and Sonenshein, 2007).

Specifications

• Antigen: c-Rel
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: REL
• Gene Alias: BCD541; C-Rel; C-Rel protein; C-Rel proto-oncogene protein; gemin 1; gemin-1; LOW QUALITY PROTEIN: proto-oncogene c-Rel; oncogene REL, avian reticuloendotheliosis; proto-oncogene c-Rel; REL; REL proto-oncogene, NF-kB subunit; reticuloendotheliosis oncogene; SMA; SMA1; SMA2; SMA3; SMA4; SMN; SMN2; SMNT; v-rel avian reticuloendotheliosis viral oncogene homolog; v-rel reticuloendotheliosis viral oncogene homolog
• Host Species: Rabbit
• Purification Method: Antigen affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 19696, 305584, 5966
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 5mg BSA and 0.05mg sodium azide
• Gene Accession No.: P15307, Q04864
• Gene Symbols: REL
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG