Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ c-Rel Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA579922
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA579922 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA579922 Supplier Invitrogen™ Supplier No. PA579922
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human THP-1 whole cell, rat spleen tissue, mouse thymus tissue. IHC: mouse Intestine tissue, rat Intestine tissue, human mammary cancer tissue.

The REL gene encodes c-Rel, a transcription factor that is a member of the Rel/NFKB family, which also includes RELA., RELB (604758), NFKB1, and NFKB2. These proteins are related through a highly conserved N-terminal region termed the 'Rel domain, ' which is responsible for DNA binding, dimerization, nuclear localization, and binding to the NFKB inhibitor (Belguise and Sonenshein, 2007).
TRUSTED_SUSTAINABILITY

Specifications

Antigen c-Rel
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 5mg BSA and 0.05mg sodium azide
Gene REL
Gene Accession No. P15307, Q04864
Gene Alias BCD541; C-Rel; C-Rel protein; C-Rel proto-oncogene protein; gemin 1; gemin-1; LOW QUALITY PROTEIN: proto-oncogene c-Rel; oncogene REL, avian reticuloendotheliosis; proto-oncogene c-Rel; REL; REL proto-oncogene, NF-kB subunit; reticuloendotheliosis oncogene; SMA; SMA1; SMA2; SMA3; SMA4; SMN; SMN2; SMNT; v-rel avian reticuloendotheliosis viral oncogene homolog; v-rel reticuloendotheliosis viral oncogene homolog
Gene Symbols REL
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence in the middle region of mouse c-Rel (268-306aa DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 19696, 305584, 5966
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.