Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C11orf53 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | C11orf53 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15759420
|
Novus Biologicals
NBP15759420UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157594
|
Novus Biologicals
NBP157594 |
100 μL |
Each for $487.50
|
|
|||||
Description
C11orf53 Polyclonal specifically detects C11orf53 in Human samples. It is validated for Western Blot.Specifications
| C11orf53 | |
| Polyclonal | |
| Rabbit | |
| Q8IXP5 | |
| 341032 | |
| Synthetic peptides corresponding to C11ORF53 The peptide sequence was selected from the middle region of C11ORF53. Peptide sequence SIAQHRGSSWGSSLAGAQSYSLHALEDLHHTPGYPTPPPYPFTPFMTVSN. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| chromosome 11 open reading frame 53, hypothetical protein LOC341032, MGC50104 | |
| C11ORF53 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title