Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C12orf50 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen C12orf50
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP156725
SDP
View Documents
Novus Biologicals
NBP156725
100 μL
Each of 1 for $487.50
Only null left
Add to Cart
 
Description

Description

C12orf50 Polyclonal specifically detects C12orf50 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C12orf50
Polyclonal
Rabbit
Q8NA57
160419
Synthetic peptides corresponding to C12ORF50 The peptide sequence was selected from the N terminal of C12ORF50. Peptide sequence INGLFLPPSSNITLQKEIQEGIPLQSQSQEPLKPQENISRPIHHPLVLKT.
Primary
Western Blot
Unconjugated
RUO
chromosome 12 open reading frame 50, FLJ35821, hypothetical protein LOC160419
C12ORF50
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.