Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C14orf177 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C14orf177 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C14orf177 Polyclonal specifically detects C14orf177 in Human samples. It is validated for Western Blot.Specifications
C14orf177 | |
Polyclonal | |
Rabbit | |
Human | |
chromosome 14 open reading frame 177, FLJ25773, hypothetical protein LOC283598, putative uncharacterized protein C14orf177 | |
C14ORF177 | |
IgG | |
14 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_872366 | |
283598 | |
Synthetic peptide directed towards the N terminal of human C14orf177The immunogen for this antibody is C14orf177. Peptide sequence HKQGTKPMITRPSVSQLGEGKCPSSQHLQSLRHNKQHALTLTKARCCGEC. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title