Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C16orf58 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C16orf58 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
C16orf58 Polyclonal specifically detects C16orf58 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
C16orf58 | |
Unconjugated | |
RUO | |
chromosome 16 open reading frame 58, FLJ13868, hypothetical protein LOC64755 | |
C16ORF58 | |
IgG |
Polyclonal | |
Rabbit | |
Q96GQ5 | |
64755 | |
Synthetic peptides corresponding to C16ORF58 The peptide sequence was selected from the N terminal of C16ORF58. Peptide sequence QAVFLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLLGIGVGN. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title