Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C18orf25 Antibody, Novus Biologicals™
SDP

Catalog No. p-200059346 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392876 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392876 Supplier Novus Biologicals Supplier No. NBP26882525UL
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

C18orf25 Polyclonal antibody specifically detects C18orf25 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen C18orf25
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias ARKadia-like 1, ARKL1, chromosome 18 open reading frame 25, hypothetical protein LOC147339, MGC12909, MGC87799
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: QDTGATWRTSGLLEELNAEAGHLDPGFLASDKTSGNAPLNEEINIASSDSEVEIVGVQEHARCVHPR
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 147339
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.