Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C1orf110 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | C1orf110 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP170449
|
Novus Biologicals
NBP170449 |
100 μL |
Each of 1 for $436.00
|
|
Description
CCDC190 Polyclonal specifically detects CCDC190 in Human samples. It is validated for Western Blot.Specifications
C1orf110 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
339512 | |
Synthetic peptides corresponding to C1ORF110 The peptide sequence was selected from the middle region of C1ORF110. Peptide sequence SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 1 open reading frame 110, FLJ41579, MGC48998, RP11-331H2.2 | |
C1ORF110 | |
IgG | |
Affinity Purified | |
34 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title