Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                C1orf74 Antibody, Novus Biologicals™
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | C1orf74 | 
|---|---|
| Applications | Western Blot | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
| Host Species | Rabbit | 
Description
C1orf74 Polyclonal specifically detects C1orf74 in Human samples. It is validated for Western Blot.Specifications
| C1orf74 | |
| Polyclonal | |
| Rabbit | |
| chromosome 1 open reading frame 74 | |
| C1ORF74 | |
| IgG | |
| 29 kDa | 
| Western Blot | |
| Unconjugated | |
| RUO | |
| 148304 | |
| Synthetic peptides corresponding to C1ORF74 The peptide sequence was selected from the N terminal of C1ORF74. Peptide sequence ICLHLAGEVLAVARGLKPAVLYDCNCAGASELQSYLEELKGLGFLTFGLH. | |
| Primary | 
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title