Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C21orf91 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | C21orf91 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP156533
|
Novus Biologicals
NBP156533 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
C21orf91 Polyclonal specifically detects C21orf91 in Human samples. It is validated for Western Blot.Specifications
| C21orf91 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C21orf14, C21orf38, C21orf7, chromosome 21 open reading frame 38, chromosome 21 open reading frame 91, CSSG1, DKFZp781D1223, early undifferentiated retina and lens, EURL, protein EURL homolog, YG81, YG81C21orf14 | |
| C21ORF91 | |
| IgG | |
| Affinity Purified |
| Western Blot | |
| Unconjugated | |
| RUO | |
| Q9NYK6-2 | |
| 54149 | |
| Synthetic peptides corresponding to C21ORF91 The peptide sequence was selected from the middle region of C21ORF91. Peptide sequence QGCPRSKLSKSTYEEVKTILSKKINWIVQYAQNKDLDSDSECSKNPQHHL. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title