Invitrogen™ C22orf29 Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA5114405

Catalog No. PIPA5114405

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human A431 whole cell, human HL-60 whole cell, human U2OS whole cell, human PC-3 whole cell, rat lung tissue, mouse HEPA1-6 whole cell. Flow: HL-60 cell, PC-3 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

C22orf29, located in mitochondrion, is involved in mitochondrial outer membrane permeabilization and regulation of mitochondrial membrane potential.

Specifications

• Antigen: C22orf29
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: RTL10
• Gene Alias: BH3-only protein; BOP; C22orf29; chromosome 22 open reading frame 29; protein Bop; Retrotransposon Gag-like protein 10; RTL10
• Host Species: Rabbit
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 79680
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and 0.05mg sodium azide
• Gene Accession No.: Q7L3V2
• Gene Symbols: RTL10
• Immunogen: A synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov