Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ C22orf29 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA5114405
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA5114405 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA5114405 Supplier Invitrogen™ Supplier No. PA5114405
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: human placenta tissue, human A431 whole cell, human HL-60 whole cell, human U2OS whole cell, human PC-3 whole cell, rat lung tissue, mouse HEPA1-6 whole cell. Flow: HL-60 cell, PC-3 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

C22orf29, located in mitochondrion, is involved in mitochondrial outer membrane permeabilization and regulation of mitochondrial membrane potential.
TRUSTED_SUSTAINABILITY

Specifications

Antigen C22orf29
Applications Flow Cytometry, Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and 0.05mg sodium azide
Gene RTL10
Gene Accession No. Q7L3V2
Gene Alias BH3-only protein; BOP; C22orf29; chromosome 22 open reading frame 29; protein Bop; Retrotransposon Gag-like protein 10; RTL10
Gene Symbols RTL10
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence of human RTL10 (EILRRLTGRAQAWAAPYLDGDLPLPDDYELFCQDLKEVVQD).
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79680
Target Species Human, Mouse, Rat
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less
WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.