Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C2orf27B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C2orf27B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C2orf27B Polyclonal specifically detects C2orf27B in Human samples. It is validated for Western Blot.Specifications
C2orf27B | |
Polyclonal | |
Rabbit | |
Human | |
chromosome 2 open reading frame 27B, hypothetical protein LOC408029, MGC50273 | |
C2ORF27B | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
Q580R0-2 | |
408029 | |
Synthetic peptides corresponding to MGC50273(MGC50273 protein) The peptide sequence was selected from the N terminal of MGC50273. Peptide sequence MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title