Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C2orf42 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C2orf42 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C2orf42 Polyclonal specifically detects C2orf42 in Human samples. It is validated for Western Blot.Specifications
C2orf42 | |
Polyclonal | |
Rabbit | |
chromosome 2 open reading frame 42 | |
C2ORF42 | |
IgG | |
63 kDa |
Western Blot | |
Unconjugated | |
RUO | |
54980 | |
Synthetic peptides corresponding to C2ORF42 The peptide sequence was selected from the N terminal of C2ORF42. Peptide sequence EPNSLRTKVPAFLSDLGKATLRGIRKCPRCGTYNGTRGLSCKNKTCGTIF. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title