Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C4orf33 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C4orf33 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C4orf33 Polyclonal specifically detects C4orf33 in Human samples. It is validated for Western Blot.Specifications
C4orf33 | |
Polyclonal | |
Rabbit | |
Q8N1A6 | |
132321 | |
Synthetic peptides corresponding to C4ORF33 The peptide sequence was selected from the C terminal of C4ORF33. Peptide sequence PNVTKFNSFAIHGSKDKRSYEALYPVPQHELQQGQKPDFHCLEYFKSFNF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 4 open reading frame 33, FLJ33703, hypothetical protein LOC132321 | |
C4ORF33 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title