Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C5orf36 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C5orf36 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C5orf36 Polyclonal specifically detects C5orf36 in Human samples. It is validated for Western Blot.Specifications
C5orf36 | |
Polyclonal | |
Rabbit | |
Q8IV33 | |
285600 | |
Synthetic peptides corresponding to C5ORF36 The peptide sequence was selected from the N terminal of C5ORF36. Peptide sequence CFEWLTNYNYSTSESSFISHGDLIKFFKTLQDLLKNEQNQEEMTLDLLWD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C5orf36, chromosome 5 open reading frame 36, DKFZp686F0372, FLJ27431, hypothetical protein LOC285600, KIAA0825, MGC34713 | |
KIAA0825 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title