Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C6orf223 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP27653225UL
Description
C6orf223 Polyclonal specifically detects C6orf223 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
C6orf223 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
chromosome 6 open reading frame 223 | |
Rabbit | |
Affinity Purified | |
RUO | |
221416.0 | |
Human | |
Purified |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
C6orf223 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MMPLAEAGALAQGGGPSATEWACILRRKTPRHKQPTLLMVRASRRSGKTSAVLKAGRQSVSGRKNSTSKDLVTLGASSLRE | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction