C6orf64 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160043

Catalog No. NBP160043

Description

SAYSD1 Polyclonal specifically detects SAYSD1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: C6orf64
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NPB0
• Gene Symbols: SAYSD1
• Immunogen: Synthetic peptides corresponding to C6ORF64 The peptide sequence was selected from the C terminal of C6ORF64. Peptide sequence MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Rabbit: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: C6orf64, chromosome 6 open reading frame 64, DKFZp434H012, FLJ11101, hypothetical protein LOC55776, SAYSVFN motif domain containing 1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55776
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.