Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
LAMTOR4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP19826320UL
Description
LAMTOR4 Polyclonal specifically detects LAMTOR4 in Mouse samples. It is validated for Western Blot.Specifications
C7orf59 | |
Polyclonal | |
Western Blot 1:1000 | |
NP_001074577 | |
LAMTOR4 | |
The immunogen for this antibody is UPF0539 protein C7orf59 N-terminal region. Peptide sequence MTSALTQGLERIPDQLGYLVLSEGAVLASSGDLENDEQAASAISELVSTA. | |
Affinity Purified | |
RUO | |
389541 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
C7orf59, chromosome 7 open reading frame 59, hypothetical protein LOC389541, late endosomal/lysosomal adaptor, MAPK and MTOR activator 4, MGC163425, MGC163431 | |
Rabbit | |
11 kDa | |
20 μL | |
Primary | |
Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction