Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
C7orf61 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | C7orf61 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
C7orf61 Polyclonal specifically detects C7orf61 in Human samples. It is validated for Western Blot.Specifications
C7orf61 | |
Polyclonal | |
Rabbit | |
Human | |
402573 | |
Synthetic peptides corresponding to LOC402573(hypothetical LOC402573) The peptide sequence was selected from the C terminal of LOC402573. Peptide sequence YLVLWAVRKHLRRLYRRQERHRRHHVRCHAAPRPNPAQSLKLDAQSPL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
chromosome 7 open reading frame 61, hypothetical protein LOC402573, IMAGE:4839025 | |
C7ORF61 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title