Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

C7orf64 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen C7orf64
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18047020
View Documents
Novus Biologicals
NBP18047020UL
20 μL
Each for $152.22
Add to cart
 
NBP180470
View Documents
Novus Biologicals
NBP180470
100 μL
Each for $436.00
Add to cart
 
Description

Description

RBM48 Polyclonal specifically detects RBM48 in Human samples. It is validated for Western Blot.
Specifications

Specifications

C7orf64
Polyclonal
Rabbit
NP_115496
84060
Synthetic peptide directed towards the C terminal of human DKFZP564O0523. Peptide sequence FLQTNPTGNEIMIGPLLPDISKVDMHDDSLNTTANLIRHKLKEVISSVPK.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
C7orf64, chromosome 7 open reading frame 64, DKFZp564O0523, DKFZp686D1651, HSPC304, hypothetical protein LOC84060, RNA binding motif protein 48
RBM48
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit