Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CA125/MUC16 Antibody (CL2782), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $646.00
Specifications
Antigen | CA125/MUC16 |
---|---|
Dilution | Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Classification | Monoclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
CA125/MUC16 Monoclonal specifically detects CA125/MUC16 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CA125/MUC16 | |
Monoclonal | |
Purified | |
RUO | |
Human | |
CA-125, CA125 ovarian cancer antigen, CA125MUC-16, FLJ14303, mucin 16, cell surface associated, mucin-16, Ovarian cancer-related tumor marker CA125, Ovarian carcinoma antigen CA125 | |
MUC16 | |
IgG1 | |
Protein A purified |
Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Unconjugated | |
Mouse | |
Cellular Markers, Extracellular Matrix, Tumor Biomarkers | |
Q8WXI7 | |
94025 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GVLVTTRRRKKEGEYNVQQQCPGYYQSHLDLEDLQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title